PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00025.314
Common NameAMTR_s00025p00224230
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family G2-like
Protein Properties Length: 435aa    MW: 47923.9 Da    PI: 4.8731
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00025.314genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.65.7e-33229283155
                                   G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                               kprlrWtpeLHe+Fveav++L G+ekAtPk il+lm+v+gLt++hvkSHLQkYR+
  evm_27.model.AmTr_v1.0_scaffold00025.314 229 KPRLRWTPELHECFVEAVNRLDGAEKATPKGILKLMNVEGLTIYHVKSHLQKYRI 283
                                               79****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.888226286IPR017930Myb domain
SuperFamilySSF466892.15E-18227283IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-31228284IPR009057Homeodomain-like
TIGRFAMsTIGR015573.5E-25229284IPR006447Myb domain, plants
PfamPF002497.9E-9231282IPR001005SANT/Myb domain
PfamPF143798.1E-21319365IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 435 aa     Download sequence    Send to blast
MALNIEPEIF DEPLPPQFRN ESSSQQGSTN ELWNPSPYIE TTNPGSSFSH SESSRHMLSQ  60
SSSFCTSLHV SSSSVPENNR HLANLPFLPD PLKGKLPASK ASSLNSFLSI SEDLKTESKE  120
HDTSENLIQD LFNLSGNASD TGLCSENYPN DDMIVTEQFD WQIISDHLDL AITDIGENPG  180
LDDIYGAPQI SSVSTSGLEC SPKHHQSLHT EATQSYSAPS PSGTSTGNKP RLRWTPELHE  240
CFVEAVNRLD GAEKATPKGI LKLMNVEGLT IYHVKSHLQK YRIAKYLPEV KEDKKNSEFE  300
EKQQPSTDGE SRIDIKMGMK VTEALRLQME VQKQLHEQLE IQRALQLRIE EHARQLQKML  360
EEQTKAGYNL MGGHSSTAPS TSAREAGSPL STSHVEPMAT TANSGGTDSE TESKASESRK  420
RARVEAGSEE ICNE*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00354DAPTransfer from AT3G13040Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006851019.20.0PREDICTED: protein PHR1-LIKE 1
TrEMBLW1PYK60.0W1PYK6_AMBTC; Uncharacterized protein
STRINGPOPTR_0007s15110.11e-108(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP7817262
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13040.24e-90G2-like family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]